PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G174300.1.p
Common NameSETIT_032375mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 310aa    MW: 35124.9 Da    PI: 4.523
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G174300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.3e-13128173247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         g WT eE+ l++++ + +G g+Wk+I++++ ++Rt+ q+ s+ qky
  Seita.2G174300.1.p 128 GFWTIEEHRLFLHGLRVYGRGNWKSISKYFVTTRTPMQVSSHAQKY 173
                         77*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.438122178IPR017930Myb domain
SuperFamilySSF466891.22E-16126179IPR009057Homeodomain-like
SMARTSM007177.0E-9126176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-10128172IPR009057Homeodomain-like
CDDcd001673.62E-9130174No hitNo description
PfamPF002492.3E-10130173IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.8E-13130176IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSPNSEQVWS VSEIMTMKSL IARHNTTTNN NTDIVEELQA RFPWKEKRQV TDLYVDLVVD  60
MIESGNQDAA ARSSHMIKDI ATSVEDPGID NLDMLYGYLM EETRSMGQVE EAQRRQTATQ  120
NERPSTTGFW TIEEHRLFLH GLRVYGRGNW KSISKYFVTT RTPMQVSSHA QKYFLKLENT  180
ARMQQRYSIN DVSLYDTEPW VLNNASGRQH GLTGGTFIPN DHSSGDELTD MNNLSEVQSP  240
LLYHANQATT GSIEVDAFAG SQQQMIGDTS TSEVPVMQGD GSQMPWTGDQ HADFFLADEW  300
IWNMDMDMK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963442.11e-85PREDICTED: uncharacterized protein LOC101780786
TrEMBLK4A0I60.0K4A0I6_SETIT; Uncharacterized protein
STRINGSi032375m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.16e-23MYB family protein